If you have been reading about reversed-phase HPLC and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2025-11-23. Numbers and descriptions here follow the published literature rather than marketing material.
BPC-157 is a synthetic peptide built from fifteen amino acids, referred to in the literature as a pentadecapeptide. Its sequence was derived from a larger protein found in human gastric juice, commonly called body protection compound. Researchers first described the fragment in the early 1990s and named it after the parent protein plus a numeric identifier. The peptide does not correspond to a single marketed medicine; it is primarily a laboratory research material. Suppliers distribute it as a lyophilized powder intended for experimental use.
Published work on BPC-157 spans several decades and covers a wide range of experimental models. Much of the early literature reports outcomes in animal studies involving induced injury to the gastrointestinal tract, tendons, and other tissues. The volume of preclinical reports is large, while controlled human trials remain scarce. This imbalance is a recurring point of discussion, because animal findings do not automatically translate into human effects. Reviews often note that study designs differ substantially across laboratories.
Interest in the peptide has grown through online communities that discuss self-administered use, which sits outside formal research settings. Regulatory status varies by country, and in many jurisdictions the compound is not approved as a therapeutic product. Questions about optimal routes of administration, long-term effects, and dose-response relationships remain open. Published pharmacokinetic data in humans are limited, and much of what circulates in popular discussion is extrapolated from animal work rather than measured directly in people.
A freeze-dried sample is generally the most stable form and is commonly held at minus twenty degrees Celsius or lower for long-term keeping, with brief transfers at room temperature. The solid is hygroscopic, so vials are warmed to ambient temperature before opening to prevent condensation from degrading the contents. Light exposure and repeated temperature cycling are both avoided in routine handling. Storage over a desiccant is a common laboratory practice that limits moisture uptake during repeated access.
Once dissolved, the material is considerably less stable than the dry solid. Aqueous solutions are usually kept cold and used within a short window, and neutral or mildly acidic buffers are preferred over strongly alkaline conditions. Freeze-thaw cycles promote aggregation and loss of material to container surfaces, so dividing a batch into single-use aliquots is standard. Adsorption to plastic and glass can lower the measured concentration, meaning solution strength may need rechecking before an experiment.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Synthetic pentadecapeptide | Fifteen amino acids; sequence matches a fragment of a gastric juice protein |
| Molecular formula | C62H98N16O22 | Corresponds to a molecular mass near 1419 Da |
| Primary origin | Fragment of human gastric juice protein BPC | First characterized in the early 1990s |
| Common synonyms | BPC 157; PL 14736; pentadecapeptide BPC 157 | Naming conventions vary across publications |
| Reported stability | Stable in gastric juice during in vitro incubation | Based on laboratory incubation, not clinical data |
Proposed mechanisms in the literature involve the nitric oxide system, vascular endothelial growth factor signaling, and epidermal growth factor receptor pathways. Some studies report changes in blood vessel formation or in inflammatory mediators, while others describe interactions with nervous tissue. Much of this evidence rests on molecular markers in cultured cells or animal models. Whether the same pathways operate the same way in humans has not been established. Authors therefore tend to describe mechanisms as hypothetical rather than settled.
Direct human evidence is scarce. One trial in ulcerative colitis delivered the compound by enema and produced limited publicly reported results without a clear benefit. The compound is not an approved medicine in most jurisdictions. In many markets it is sold as a research chemical; in others it falls under prescription or controlled categories. Regulators have not confirmed any claimed medical use, and product labels rarely undergo premarket review.
BPC-157 is a synthetic fifteen-amino-acid peptide whose sequence is GEPPPGKPADDAGLV. Its name derives from the phrase body protection compound, a term applied to a protein fraction originally detected in human gastric juice. The short peptide is not that full protein; it corresponds to a stable fragment of the larger molecule. Researchers frequently describe it as a pentadecapeptide because it contains exactly fifteen residues. Its neutral molecular mass is approximately 1419 daltons.
The sequence places several glycine and proline residues near the middle, which may influence how the chain folds in solution. The peptide is linear rather than cyclic, and it carries no disulfide bridges. Commercial material is commonly supplied as the acetate salt, although the free base and other counterion forms also appear. Because the term BPC-157 refers to a specific sequence, samples with slight sequence variants are chemically different substances. Published work generally treats the fifteen-residue sequence as the defining structure.
Physical descriptions in supplier documents and papers usually list the compound as a white to off-white powder. It dissolves readily in water and in common aqueous buffers, and solutions are often prepared fresh before an experiment. Molecular mass near 1419 daltons helps verify identity during mass spectrometry. The powder is somewhat hygroscopic, so moisture exposure can alter the measured mass of a sample. Purity is typically reported as a percentage from chromatographic analysis.
The main chemical liabilities of this sequence are peptide-bond hydrolysis and possible aspartate-related reactions, since the peptide contains aspartic acid residues but no cysteine, methionine, or tryptophan. Absence of those three residues removes the most common oxidation and disulfide pathways from consideration. Studies of related peptides indicate that aspartate isomerisation and aspartimide formation occur most readily at Asp-Gly and Asp-Ala positions, and open questions remain about how quickly those reactions proceed under ordinary laboratory conditions. Storage guidance typically emphasises cool, dry, dark conditions to slow hydrolysis.
Identity and purity are usually assessed with reversed-phase high-performance liquid chromatography, often paired with mass spectrometry using electrospray or MALDI ionisation. Amino acid analysis and peptide mapping by enzymatic digestion provide additional sequence-level confirmation. Purity is commonly reported as an area percentage from a chromatographic trace, and water content can be measured by Karl Fischer titration. Reported masses may differ by tens of daltons between sources because preparations can contain acetate or trifluoroacetate counterions, and such differences are not by themselves evidence of a different peptide.
BPC-157 is normally distributed as a lyophilised powder that ranges from white to off-white in appearance. The peptide dissolves readily in water, normal saline, and common aqueous buffers, and it is poorly soluble in nonpolar solvents such as hexane or vegetable oils. Lyophilised vials take up moisture if left open, which changes the mass of powder in the container and complicates any later weighing. Because the material is handled in small quantities, static and adhesion to glass or plastic can also cause noticeable losses during transfer.
== Chemistry == Grammotoxin is a 36 amino acid protein toxin, with the sequence Asp-Cys-Val-Arg-Phe-Trp-Gly-Lys-Cys-Ser-Gln-Thr-Ser-Asp-Cys-Cys-Pro-His-Leu-Ala-Cys-Lys-Ser-Lys-Trp-Pro-Arg-Asn-Ile-Cys-Val-Trp-Asp-Gly-Ser-Val (DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV), and disulfide bridges between Cys2-Cys16, Cys9-Cys21 and Cys15-Cys30. It forms an inhibitor cystine knot motif, common in spider toxins. Its chemical formula is: C177H268N52O50S6 Grammotoxin can be purified from Grammostola spatulata venom by reverse phase high performance liquid chromatography.
The total energy gained from the complete breakdown of one (six-carbon) molecule of glucose by glycolysis, the formation of 2 acetyl-CoA molecules, their catabolism in the citric acid cycle, and oxidative phosphorylation equals about 30 ATP molecules, in eukaryotes. The number of ATP molecules derived from the beta oxidation of a 6 carbon segment of a fatty acid chain, and the subsequent oxidation of the resulting 3 molecules of acetyl-CoA is 40.
== Dedicated software == Ion mobility mass spectrometry is a rather recently popularized gas phase ion analysis technique. As such there is not a large software offering to display and analyze ion mobility mass spectrometric data, apart from the software packages that are shipped along with the instruments. ProteoWizard, OpenMS, and msXpertSuite are free software according to the OpenSourceInitiative definition. While ProteoWizard and OpenMS have features to allow spectrum scrutiny, those software packages do not provide combination features. In contrast, msXpertSuite features the ability to combine spectra according to various criteria: retention time, m/z range, drift time range, for example. msXpertSuite thus more closely mimics the software that usually comes bundled with the mass spectrometer.
Sources: en.wikipedia.org
=== Synthetic Yeast 2.0 === As part of the Synthetic Yeast 2.0 project, various research groups around the world have participated in a project to synthesise synthetic yeast genomes, and through this process, optimise the genome of the model organism Saccharomyces cerevisiae. The Yeast 2.0 project applied various DNA assembly methods that have been discussed above, and in March 2014, Jef Boeke of the Langone Medical Centre at New York University, revealed that his team had synthesized chromosome III of S. cerevisiae. The procedure involved replacing the genes in the original chromosome with synthetic versions and the finished synthetic chromosome was then integrated into a yeast cell. It required designing and creating 273,871 base pairs of DNA – fewer than the 316,667 pairs in the original chromosome. In March 2017, the synthesis of 6 of the 16 chromosomes had been completed, with synthesis of the others still ongoing.
=== Economics === Pregabalin is available as a generic medication in a number of countries, including the United States as of July 2019. In the United States as of July 2019 the wholesale/pharmacy cost for generic pregabalin is $0.17–0.22 per 150-mg capsule. From 2008 until 2018, Pfizer engaged in extensive direct-to-consumer advertising campaigns to promote its branded product Lyrica for fibromyalgia and diabetic nerve pain indications. In January 2016, the company spent a record amount, $24.6 million for a single drug on TV ads, reaching global revenues of $14 billion, more than half in the United States. Up until 2009, Pfizer promoted Lyrica for other uses that had not been approved by medical regulators. For Lyrica and three other drugs, Pfizer was fined a record amount of $2.3 billion by the Department of Justice, after pleading guilty to advertising and branding "with the intent to defraud or mislead". Pfizer illegally promoted the drugs, with doctors "invited to consultant meetings, many in resort locations; attendees expenses were paid; they received a fee just for being there", according to prosecutor Michael Loucks.
=== Pharmacokinetics === Temozolomide is quickly and almost completely absorbed from the gut, and readily penetrates the blood–brain barrier; the concentration in the cerebrospinal fluid is 30% of the concentration in the blood plasma. Intake with food decreases maximal plasma concentrations by 33% and the area under the curve by 9%. Only 15% (10–20%) of the substance are bound to blood plasma proteins. Temozolomide is a prodrug; at physiological pH, it is spontaneously hydrolyzed to 5-(3-methyl-triazen-1-yl)imidazole-4-carboxamide (MTIC), which undergoes further hydrolysis to methyldiazonium, likely the active methylating agent, and 5-aminoimidazole-4-carboxamide (AIC). Other metabolites include temozolomide acid and unidentified hydrophilic substances. Plasma half-life is 1.8 hours. The substance and its metabolites are mainly excreted via the urine.
=== Regulatory approach === Unlike the European Union, which enacted the comprehensive, risk-based EU AI Act (Regulation (EU) 2024/1689), the UK has maintained a "pro-innovation" and sector-specific regulatory approach. Rather than creating a single AI regulator or primary legislation, the UK relies on existing sector-specific regulator, including the Competition and Markets Authority (CMA), the Information Commissioner's Office (ICO), the Financial Conduct Authority (FCA), and Ofcom, to apply cross-cutting principles of safety, transparency, fairness, accountability, and contestability to AI systems within their respective domains.
Sources: en.wikipedia.org
Because pellagra outbreaks occurred in regions where maize was a dominant food crop, the most convincing hypothesis during the late 19th century, as espoused by Cesare Lombroso, was that the maize either carried a toxic substance or was a carrier of disease. Louis Sambon, an Anglo-Italian doctor working at the London School of Tropical Medicine, was convinced that pellagra was carried by an insect, along the lines of malaria. Later, the lack of pellagra outbreaks in Mesoamerica, where maize is a major food crop, led researchers to investigate processing techniques in that region. Pellagra was studied mostly in Europe until the late 19th century, when it became epidemic especially in the Southern United States. In the early 1900s, pellagra reached epidemic proportions in the American South. Between 1906 and 1940 more than 3 million Americans were affected by pellagra with more than 100,000 deaths, yet the epidemic resolved itself right after dietary niacin fortification. Pellagra deaths in South Carolina numbered 1,306 during the first 10 months of 1915; 100,000 Southerners were affected in 1916. At this time, the scientific community held that pellagra was probably caused by a germ or some unknown toxin in corn.
== Abstracting and indexing == The journal is abstracted and indexed in Biological Abstracts, Chemical Abstracts, Current Contents/Life Sciences, EMBiology, Food Science and Technology Abstracts, MEDLINE, Science Citation Index and Scopus.
=== The efficiency of EI === Increasing the electron ionization process is done by increasing the ionization efficiency. In order to achieve higher ionization efficiency there should be an optimized filament current, emission current, and ionizing current. The current supplied to the filament to heat it to incandescent is called the filament current. The emission current is the current measured between the filament and the electron entry slit. The ionizing current is the rate of electron arrival at the trap. It is a direct measure of the number of electrons in the chamber that are available for ionization. The sample ion current (I+) is the measure of the ionization rate. This can be enhanced by manipulation of the ion extraction efficiency (β), the total ionizing cross section (Qi), the effective ionizing path length (L), the concentration of the sample molecules([N]) and the ionizing current (Ie). The equation can be shown as follows:
Sources: en.wikipedia.org
It is a synthetic peptide of fifteen amino acids whose sequence matches a fragment of a protein found in human gastric juice. It is studied mainly in laboratory and animal research rather than as an approved medicine.
The letters abbreviate body protection compound, the name given to the parent protein isolated from gastric juice. The number is an identifier attached to the specific fragment, not a dose or a description of a chemical property.
The sequence corresponds to a segment of an endogenous gastric protein, but the isolated fifteen-amino-acid peptide is a synthetic construct. Whether the free fragment circulates in humans at measurable levels is not clearly established in the published literature.
Low temperature slows the chemical reactions, such as oxidation and hydrolysis, that break down a peptide chain. Water and oxygen are the main drivers of degradation, so a cold and dry environment extends usable life. Actual shelf life depends on the batch, the salt form, and the container.