This is a working overview of pentadecapeptide, written for readers who want more than a one-paragraph summary but less than a textbook.
This page was last updated on 2025-11-16 and is reviewed periodically as new material appears.
BPC-157 is a synthetic pentadecapeptide with the sequence GEPPPGKPADDAGLV, corresponding to a partial fragment of a larger protein detected in human gastric juice. The name derives from the parent protein designation BPC, an abbreviation of body protection compound, with 157 acting as a fraction or batch identifier used by the original investigators. Its molecular weight is approximately 1419 daltons, and the chain contains no unusual residues or disulfide bridges. In the literature it is described as a short, water-soluble fragment rather than a complete natural protein.
Most early work on this peptide originated in the 1990s from a research group in Zagreb, Croatia, relying on animal models and cell cultures. Reported observations included effects on gastrointestinal lesion healing, tendon fibroblast migration, and blood vessel formation under controlled laboratory conditions. These findings come predominantly from rodent studies and in vitro assays rather than from human trials. Controlled human data remain limited, and the degree to which animal results translate to human physiology is an open question rather than a settled fact.
BPC-157 is normally distributed as a lyophilised powder that ranges from white to off-white in appearance. The peptide dissolves readily in water, normal saline, and common aqueous buffers, and it is poorly soluble in nonpolar solvents such as hexane or vegetable oils. Lyophilised vials take up moisture if left open, which changes the mass of powder in the container and complicates any later weighing. Because the material is handled in small quantities, static and adhesion to glass or plastic can also cause noticeable losses during transfer.
The main chemical liabilities of this sequence are peptide-bond hydrolysis and possible aspartate-related reactions, since the peptide contains aspartic acid residues but no cysteine, methionine, or tryptophan. Absence of those three residues removes the most common oxidation and disulfide pathways from consideration. Studies of related peptides indicate that aspartate isomerisation and aspartimide formation occur most readily at Asp-Gly and Asp-Ala positions, and open questions remain about how quickly those reactions proceed under ordinary laboratory conditions. Storage guidance typically emphasises cool, dry, dark conditions to slow hydrolysis.
Identity and purity are usually assessed with reversed-phase high-performance liquid chromatography, often paired with mass spectrometry using electrospray or MALDI ionisation. Amino acid analysis and peptide mapping by enzymatic digestion provide additional sequence-level confirmation. Purity is commonly reported as an area percentage from a chromatographic trace, and water content can be measured by Karl Fischer titration. Reported masses may differ by tens of daltons between sources because preparations can contain acetate or trifluoroacetate counterions, and such differences are not by themselves evidence of a different peptide.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C62H98N16O22 | computed for the free peptide |
| Molecular weight | about 1419 Da | monoisotopic mass near 1418.7 |
| Amino acid count | 15 | single chain, no disulfide bonds |
| Solubility | freely soluble in water | also dissolves in saline and phosphate buffer |
| Common synonyms | pentadecapeptide BPC, BPC 157 | fragment notation varies by source |
Proposed mechanisms in the literature involve the nitric oxide system, vascular endothelial growth factor signaling, and epidermal growth factor receptor pathways. Some studies report changes in blood vessel formation or in inflammatory mediators, while others describe interactions with nervous tissue. Much of this evidence rests on molecular markers in cultured cells or animal models. Whether the same pathways operate the same way in humans has not been established. Authors therefore tend to describe mechanisms as hypothetical rather than settled.
Direct human evidence is scarce. One trial in ulcerative colitis delivered the compound by enema and produced limited publicly reported results without a clear benefit. The compound is not an approved medicine in most jurisdictions. In many markets it is sold as a research chemical; in others it falls under prescription or controlled categories. Regulators have not confirmed any claimed medical use, and product labels rarely undergo premarket review.
Interest in the peptide has grown through online communities that discuss self-administered use, which sits outside formal research settings. Regulatory status varies by country, and in many jurisdictions the compound is not approved as a therapeutic product. Questions about optimal routes of administration, long-term effects, and dose-response relationships remain open. Published pharmacokinetic data in humans are limited, and much of what circulates in popular discussion is extrapolated from animal work rather than measured directly in people.
BPC-157 is a synthetic peptide built from fifteen amino acids, referred to in the literature as a pentadecapeptide. Its sequence was derived from a larger protein found in human gastric juice, commonly called body protection compound. Researchers first described the fragment in the early 1990s and named it after the parent protein plus a numeric identifier. The peptide does not correspond to a single marketed medicine; it is primarily a laboratory research material. Suppliers distribute it as a lyophilized powder intended for experimental use.
Published work on BPC-157 spans several decades and covers a wide range of experimental models. Much of the early literature reports outcomes in animal studies involving induced injury to the gastrointestinal tract, tendons, and other tissues. The volume of preclinical reports is large, while controlled human trials remain scarce. This imbalance is a recurring point of discussion, because animal findings do not automatically translate into human effects. Reviews often note that study designs differ substantially across laboratories.
Common synonyms in catalogs include pentadecapeptide BPC 157, BPC157, and the full sequence name. A CAS registry number in the 137525-51-0 range is frequently listed, though the assignment should be verified against the supplier certificate of analysis. The name itself is not a pharmacopoeial designation, and there is no standardized international nonproprietary name. Distinguishing genuine material from related fragments generally requires mass spectrometry, since several truncated sequences share similar chromatographic behavior.
BPC-157 is a synthetic pentadecapeptide whose sequence is commonly given as Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val. It is described in the literature as a fragment of a larger protein found in human gastric juice, referred to as body protection compound. The peptide was first characterized in the early 1990s by a research group in Zagreb, Croatia. Its molecular formula is C62H98N16O22 and its monoisotopic mass is approximately 1419 daltons.
Identity and purity are checked with standard peptide techniques. Reversed-phase high-performance liquid chromatography separates the main peak from closely related impurities and yields a percentage purity. Mass spectrometry confirms that the measured mass matches the theoretical value. Amino acid analysis offers an independent check on overall composition. These analytical methods characterize the material itself and reveal nothing about how it behaves in a living system.
In its common research form the peptide is supplied as a lyophilized powder. It dissolves readily in water and in typical aqueous buffers, which simplifies preparation of working solutions. Laboratories usually prepare small aliquots instead of one large volume. The dry material appears as a white to off-white solid with no distinctive odor. Bulk quantities are typically shipped in sealed vials.
Lyophilized material is generally kept cold, commonly at minus twenty degrees Celsius, and shielded from moisture and light. Solutions are less stable than the dry powder, so repeated freeze-thaw cycles are avoided by splitting the material into single-use portions. Published stability data for this particular peptide are limited, which means suggested hold times should be read as provisional. Long-term refrigeration of reconstituted solutions is not well supported by available evidence.
They found similar spheres in a variety of other fossils from various periods, including an ammonite. In the ammonite, they found the spheres in a place where the iron they contain could not have had any relationship to the presence of blood. Schweitzer has strongly criticized Kaye's claims and argues that there is no reported evidence that biofilms can produce branching, hollow tubes like those noted in her study. San Antonio, Schweitzer and colleagues published an analysis in 2011 of what parts of the collagen had been recovered, finding that it was the inner parts of the collagen coil that had been preserved, as would have been expected from a long period of protein degradation. Other research challenges the identification of soft tissue as biofilm and confirms finding "branching, vessel-like structures" from within fossilized bone.
==== Nutritional supplements ==== OI is a genetic disorder and is not caused by insufficient intake of any vitamin or mineral; supplementation cannot cure OI. Nevertheless, people with OI tend to be severely deficient in vitamin D at much higher rates than the general population, and the cause of this is not well understood. The severity of the deficiency and the likelihood of its occurrence is thought to be related to severity of OI. Vitamin D supplementation may be recommended, at least until levels of 25(OH)D3 in a patient's blood return to normal. Vitamin D deficiency is also a concern as it may decrease the benefit of bisphosphanates.
There is currently no use for any isotope of berkelium outside basic scientific research. Berkelium-249 is a common target nuclide to prepare still heavier transuranium elements and superheavy elements, such as lawrencium, rutherfordium and bohrium. It is also useful as a source of the isotope californium-249, which is used for studies on the chemistry of californium in preference to the more radioactive californium-252 that is produced in neutron bombardment facilities such as the HFIR. A 22 milligram batch of berkelium-249 was prepared in a 250-day irradiation and then purified for 90 days at Oak Ridge in 2009. This target yielded the first 6 atoms of tennessine at the Joint Institute for Nuclear Research (JINR), Dubna, Russia, after bombarding it with calcium ions in the U400 cyclotron for 150 days. This synthesis was a culmination of the Russia-US collaboration between JINR and Lawrence Livermore National Laboratory on the synthesis of elements 113 to 118 which was initiated in 1989.
Sources: en.wikipedia.org
== Technology == Aroa Biosurgery develops medical devices using its proprietary ovine forestomach matrix (OFM) technology. OFM is a layer of decellularized extracellular matrix (ECM) biomaterial isolated from the propria submucosa of the rumen of sheep. OFM is used in tissue engineering and as a tissue scaffold for wound healing and surgical applications.
(+)-Menthofuran synthase (EC 1.14.14.143, menthofuran synthase, (+)-pulegone 9-hydroxylase, (+)-MFS, cytochrome P450 menthofuran synthase) is an enzyme with systematic name (+)-pulegone,NADPH:oxygen oxidoreductase (9-hydroxylating). This enzyme catalyses the following chemical reaction
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP.
Patients who do not drink may require fluids by nasogastric tube. Intravenous fluids are recommended only in those who have significant dehydration due to their potential complications, including congestive heart failure.
Sources: en.wikipedia.org
Qìgōng (气功; 氣功) is a TCM system of exercise and meditation that combines regulated breathing, slow movement, and focused awareness, purportedly to cultivate and balance qi. One branch of qigong is Qigong massage, in which the practitioner combines massage techniques with awareness of the acupuncture channels and points. Qi is air, breath, energy, or primordial life source that is neither matter or spirit. While Gong is a skillful movement, work, or exercise of the qi.
== Disease associations == The vast majority of patients with positive HLA-B27 will not develop an associated syndrome. The relationship between HLA-B27 and many diseases has not yet been fully elucidated. Though HLA-B27 is associated with a wide range of pathology, it does not appear to be the sole mediator in the development of disease. 90% of people with ankylosing spondylitis (AS) are HLA-B27 positive, although only a small fraction of people with HLA-B27 will develop AS. People who are HLA-B27 positive are more likely to experience early onset AS than HLA-B27 negative individuals. Research is uncovering other genes that predispose to AS and associated diseases, and there are potential environmental factors that may play a role in susceptible individuals. Approximately 40–50% of individuals with psoriatic arthritis have the HLA-B27 genotype. HLA-B27 is implicated in other types of seronegative spondyloarthropathy, such as reactive arthritis, acute anterior uveitis, iritis, Crohn's disease, and ulcerative colitis associated spondyloarthritis. The shared association with HLA-B27 leads to increased clustering of these diseases. HLA antigens have been studied in relation to autism.
=== Medical === Bimatoprost is used for the treatment of open-angle glaucoma and ocular hypertension in adults, either alone or in combination with a beta blocker, typically timolol. Studies have shown bimatoprost to be more effective than timolol in reduction of intraocular pressure (IOP) and at least as effective as the prostaglandin analogs latanoprost and travoprost in reducing IOP.
==== Corneal Allogenic Intrastromal Ring Segments (CAIRS) ==== Corneal Allogenic Intrastromal Ring Segment Keratoplasty (CAIRS Keratoplasty) is a modern surgical technique used in the treatment of keratoconus. It involves implanting finely shaped pieces of donor corneal tissue into the corneal stroma to reinforce and reshape the weakened, ectatic cornea, thereby improving both corneal structure and visual clarity. Because CAIRS uses biological graft material and has demonstrated strong outcomes with a favourable safety profile, it is formally recognised as a corneal transplantation procedure by health funding authorities in Australia, the United Kingdom, Japan, Germany, Brazil, the Netherlands, and a number of other countries. In contrast to traditional synthetic intrastromal corneal ring segments (ICRS) made from materials such as PMMA, CAIRS keratoplasty uses preserved allogeneic corneal tissue. This biological compatibility reduces the likelihood of complications sometimes seen with non-organic implants, including extrusion, infection, or chronic foreign body reaction. The CAIRS technique was pioneered by Dr Soosan Jacob, who first introduced it in 2018 through a large case series published in the Journal of Refractive Surgery. One of its key strengths is its suitability for corneas with irregular or decentered cones. The donor segments can be individually designed to achieve targeted corneal flattening and astigmatism improvement.
In 1943, astatine was found as a product of two naturally occurring decay chains by Berta Karlik and Traude Bernert, first in the so-called uranium series, and then in the actinium series. (Since then, astatine was also found in a third decay chain, the neptunium series.) Friedrich Paneth in 1946 called to finally recognize synthetic elements, quoting, among other reasons, recent confirmation of their natural occurrence, and proposed that the discoverers of the newly discovered unnamed elements name these elements. In early 1947, Nature published the discoverers' suggestions; a letter from Corson, MacKenzie, and Segrè suggested the name "astatine" coming from the Ancient Greek ástatos (ἄστατος) meaning 'unstable', because of its propensity for radioactive decay, with the ending "-ine", found in the names of the four previously discovered halogens. The name was also chosen to continue the tradition of the four stable halogens, where the name referred to a property of the element. Corson and his colleagues classified astatine as a metal on the basis of its analytical chemistry. Subsequent investigators reported iodine-like, cationic, or amphoteric behavior. In a 2003 retrospective, Corson wrote that "some of the properties [of astatine] are similar to iodine ... it also exhibits metallic properties, more like its metallic neighbors Po and Bi."
Sources: en.wikipedia.org
The sequence corresponds to a fragment of a protein found in human gastric juice, so related sequences are natural. The isolated fifteen-amino-acid peptide supplied for research is produced synthetically. Whether the free fragment circulates naturally in humans has not been settled.
In most jurisdictions it is not an approved medicine and is handled as a research material. Import and sale rules differ by country, and some regulators have placed it in categories that restrict human use. Status can change, so current local rules apply.
Rodent models dominate, particularly rats with induced gastric lesions, tendon injury, or vascular disruption. These designs allow controlled comparison but differ anatomically and metabolically from humans. Results from such models are commonly cited as preliminary.
Lyophilised peptide powders are generally kept frozen or refrigerated, dry, and protected from light. Sealed vials limit moisture uptake and slow hydrolysis. Such guidance comes from general peptide chemistry rather than from stability studies specific to every product.