research chemical comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Last reviewed on 2026-07-11. Where a claim depends on a specific study, the study is described rather than over-claimed.
Identity and purity are usually assessed by reversed-phase high-performance liquid chromatography with ultraviolet detection near 214 nanometers, a wavelength that captures the peptide backbone. The main peak area is reported as a percentage of total peak area, which serves as a conventional purity figure. Mass spectrometry provides an independent check on molecular mass and helps confirm the expected sequence. Additional tests may include amino acid analysis and water content determination. Results are only comparable when the same column, gradient, and detection settings are used.
Peptides are susceptible to hydrolysis, oxidation, and aggregation, and BPC-157 is no exception. The lyophilized powder form is generally more stable than a solution because residual moisture is low and molecular mobility is reduced. Once dissolved, the peptide is exposed to water, oxygen, and trace metal ions that accelerate degradation. Light exposure and repeated freeze-thaw cycles are also commonly cited as sources of loss. These general principles guide most handling recommendations found in supplier documentation.
Standard practice for the solid form is storage at minus twenty degrees Celsius or colder, kept dry and away from light. Containers are usually sealed with a desiccant to limit moisture uptake. Reconstituted solutions are typically held at two to eight degrees Celsius and used within a short window, because potency can decline over days to weeks depending on the buffer and concentration. Freezing an already dissolved sample may help, though repeated thawing is discouraged. Specific shelf-life claims vary between suppliers and are rarely supported by published stability studies.
Direct human evidence is scarce. One trial in ulcerative colitis delivered the compound by enema and produced limited publicly reported results without a clear benefit. The compound is not an approved medicine in most jurisdictions. In many markets it is sold as a research chemical; in others it falls under prescription or controlled categories. Regulators have not confirmed any claimed medical use, and product labels rarely undergo premarket review.
Most published reports describe experiments in rodents rather than in people. These studies examine outcomes in tendons, ligaments, bone, stomach lining, and intestinal tissue. In rat and mouse models, a frequently reported effect is faster healing or reduced damage. Sample sizes are usually small, and a substantial share of the work originates from a small number of research groups. Independent replication is limited, so how far the findings extend to humans remains an open question.
| Property | Value | Notes |
|---|---|---|
| Lyophilized powder storage | -20 C or colder, desiccated, protected from light | Long-term condition cited in supplier documentation |
| Reconstituted solution storage | 2-8 C for short-term use | Stability decreases after dissolution |
| Appearance | White to off-white lyophilized powder | Used as a visual identity check |
| Solubility | Soluble in water and aqueous buffers | Limited solubility in nonpolar organic solvents |
| Typical analytical method | Reversed-phase HPLC with UV detection at 214 nm | Purity estimate; mass spectrometry confirms molecular mass |
Terminology in the literature is not fully standardised. Papers and product listings use BPC-157, BPC 157, and the longer phrase stable gastric pentadecapeptide BPC 157 interchangeably, and synonyms such as bepecin or PL 14736 appear in older or company-linked publications. Purity claims and reported masses can also differ between sources because peptide preparations may include counterions, residual solvents, or bound water. This variability complicates direct comparison of results across studies and makes the exact identity and grade of a given sample worth verifying. Discussions of the compound should therefore specify the source, salt form, and stated purity where those are known.
BPC-157 is a synthetic peptide composed of fifteen amino acid residues, with the sequence Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val. Its name derives from body protection compound, a term used for a protein fraction identified in human gastric juice. Researchers in Zagreb first reported the pentadecapeptide in the early 1990s and described it as a stable fragment of that larger protein. The compound is also catalogued as PL 14736 and, in some commercial contexts, as bepecin. Its molecular formula is C62H98N16O22 and its monoisotopic mass is approximately 1419 daltons.
Most published work on BPC-157 consists of preclinical studies, including rodent models of tissue injury, gastrointestinal lesions, and vascular or tendon damage, together with in vitro cell assays. Reviews frequently note that the mechanisms proposed in these papers remain incompletely characterised and that findings have not been confirmed in large randomised human trials. The compound is widely sold as a research chemical rather than a licensed medicine, and labels commonly carry a statement that it is not for human use. Whether any of the reported animal effects translate to humans is an open question rather than an established result.
Evidence in humans is limited. Small clinical studies have examined the peptide in contexts such as ulcerative colitis and wound healing, but participant numbers are small and independent replication is scarce. It is not approved as a medicine by major regulatory agencies and is distributed mainly as a research material or compounded preparation. Long-term human safety data are not established, and questions about absorption through non-injected routes remain open rather than resolved. Claims about its effects are best read against these gaps.
BPC-157 is a synthetic peptide of fifteen amino acids, written in single-letter code as GEPPPGKPADDAGLV. The sequence corresponds to a partial fragment of a protein isolated from human gastric juice, described in early reports as body protection compound. The number 157 refers to a fragment designation in that work rather than to molecular mass. Initial descriptions appeared in the early 1990s, when the fragment was reported to protect gastrointestinal tissue in animal models. Commercial material is produced by solid-phase peptide synthesis rather than extracted from biological sources.
Laboratory research on this peptide has examined a wide and heterogeneous set of endpoints, including gastric ulcer models, tendon and ligament injury, wound closure, and intestinal inflammation. Most published findings come from rodent studies, and reported effect sizes are often large relative to controls. Because the compound has been tested across many unrelated injury models, the literature is frequently described as unusually broad for a single peptide. A substantial share of this work originates from a small number of research groups, which matters when assessing how widely results have been reproduced.
== History == Ninhydrin was discovered in 1910 by the German-English chemist Siegfried Ruhemann (1859–1943). In the same year, Ruhemann observed ninhydrin's reaction with amino acids. In 1954, Swedish investigators Oden and von Hofsten proposed that ninhydrin could be used to develop latent fingerprints.
=== Cancer === One of MMP9's most widely associated pathologies is the relationship to cancer, due to its role in extracellular matrix remodeling and angiogenesis. For example, its increased expression was seen in a metastatic mammary cancer cell line. Gelatinase B plays a central role in tumor progression, from angiogenesis, to stromal remodeling, and ultimately metastasis. However, because of its physiologic function, it may be difficult to leverage Gelatinase B inhibition into cancer therapy modalities. However, Gelatinase B has been investigated in tumor metastasis diagnosis- Complexes of Gelatinase B/Tissue Inhibitors of Metalloproteinases are seen to be increased in gastrointestinal cancer and gynecologic malignancies MMPs such as MMP9 can be involved in the development of several human malignancies, as degradation of collagen IV in basement membrane and extracellular matrix facilitates tumor progression, including invasion, metastasis, growth and angiogenesis.
In 1929–30, Parke, Davis & Co., a major US drug manufacturer based in Detroit, Michigan, sold "Opium, U.S.P. (Laudanum)", as Tincture No. 23, for $10.80 per pint (16 fluid ounces), and "Opium Camphorated, U.S.P. (Paregoric)", as Tincture No. 20, for $2.20 per pint. Concentrated versions were available. "Opium Camphorated, for U.S.P. Tincture: Liquid No. 338" was "exactly 8 times the strength of Tincture Opium Camphorated (Paregoric) [italics in original], U.S.P., "designed for preparing the tincture by direct dilution," and cost $7 per pint. Similarly, at a cost of $36 per pint, "Opium Concentrated, for U.S.P. Tincture: Liquid No. 336", was "four times the strength of the official tincture", and "designed for the extemporaneous preparation of the tincture". The catalog also noted: "For quarter-pint bottles add 80c. per pint to the price given for pints." Toward the middle 20th century, the use of opiates was generally limited to the treatment of pain, and opium was no longer a medically accepted 'cure-all'. Further, the pharmaceutical industry began synthesizing various opioids, such as propoxyphene, oxymorphone and oxycodone. These synthetic opioids, along with codeine and morphine were preferable to laudanum since a single opioid could be prescribed for different types of pain rather than the 'cocktail of laudanum, which contains nearly all of the opium alkaloids. Consequently, laudanum became mostly obsolete as an analgesic, since its principal ingredient is morphine, which can be prescribed by itself to treat pain.
==== Pregnancy ==== It has not been shown to cause birth defects in animal studies when given intravenously. There are no controlled studies to show if pentamidine can harm the fetus in pregnant women. It is only recommended if the drug of choice trimethoprim-sulfamethoxazole is contraindicated.
It has been suspected that the Bolivian police themselves have a responsibility in promoting anti-Peruvian xenophobia, trying to blame Peruvians for the increase in crime (in instead of Bolivia's internal problems), as well as not efficiently preserving the human rights of Peruvian migrants in the face of outrages. For example, Colonel Javier Gómez Bustillos of the Bolivian Police (markedly anti-Peruvian) would have carried out attacks to Peruvian citizens in May 2001, and despite this, he continued to receive the protection of his government and his institution, who would have promoted him to the best positions in his institution instead of making him answer to the law. The Bolivian press and The media would have helped the development of this current of anti-Peruvian opinion, getting it to position itself in the Bolivian masses, by giving great emphasis in its programs to criminal acts carried out by Peruvian migrants, including the most serious crimes such as drug trafficking and those related to subversion. The death of a Peruvian soldier, the sailor Juan Vega Llana, also contributed to the latter, due to the fact that he was assassinated, in a central street of La Paz, by Peruvian people (classified as subversive) who were members of the terrorist group Sendero Luminoso, who They sought revenge for the Massacre in the prisons of Peru.
Sources: en.wikipedia.org
=== Excretory system === The excretory system contains a pair of nephridia in every segment, except for the first three and the last ones. The three types of nephridia are: integumentary, septal, and pharyngeal. The integumentary nephridia lie attached to the inner side of the body wall in all segments except the first two. The septal nephridia are attached to both sides of the septa behind the 15th segment. The pharyngeal nephridia are attached to the fourth, fifth and sixth segments. The waste in the coelom fluid from a forward segment is drawn in by the beating of cilia of the nephrostome. From there it is carried through the septum (wall) via a tube which forms a series of loops entwined by blood capillaries that also transfer waste into the tubule of the nephrostome. The excretory wastes (urine) are then finally discharged through a pore on the worm's side. This classification has been further refined, with holonephridia, large and occurring as a pair per segment, and meronephridia, small and numerous in each segment, each type being either closed or open, and exonephric or enteronephric according as they discharge their excretory products to the exterior or into the gut. Earthworm urine contains a protein part derived from the mucus secreted by the body wall, and another part, representing the end products of metabolism excreted by nephridia, made of a mixing of ammonia and urea.
ALDHs function in cell differentiation, proliferation, oxidation, and drug resistance. These enzymes are only one example of the many different types of dehydrogenases in the human body; their wide array of functions, and the impact that their deactivation or mutations has upon crucial cell processes underscores the importance of all dehydrogenases in maintaining body homeostasis.
It is a very specific tag that can be used for purification of membrane proteins. S-tag, a peptide derived from Ribonuclease A (KETAAAKFERQHMDS) SBP-tag, a peptide which binds to streptavidin (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP) Softag 1, for mammalian expression (SLAELLNAGLGGS) Softag 3, for prokaryotic expression (TQDPSRVG) Spot-tag, a peptide recognized by a nanobody (PDRVRAVSHWSS) for immunoprecipitation, affinity purification, immunofluorescence and super resolution microscopy Strep-tag, a peptide which binds to streptavidin or the modified streptavidin called streptactin (Strep-tag II: WSHPQFEK) T7-tag, an epitope tag derived from the T7 major capsid protein of the T7 gene (MASMTGGQQMG). Used in different immunoassays as well as affinity purification Mainly used TC tag, a tetracysteine tag that is recognized by FlAsH and ReAsH biarsenical compounds (CCPGCC) Ty tag (EVHTNQDPLD) V5 tag, a peptide recognized by an antibody (GKPIPNPLLGLDST) VSV-tag, a peptide recognized by an antibody (YTDIEMNRLGK) Xpress tag (DLYDDDDK), a peptide recognized by an antibody
=== Perrault method === This approach, discovered by Perrault and Chan in 2009, uses hydroquinone to reduce HAuCl4 in an aqueous solution that contains 15 nm gold nanoparticle seeds. This seed-based method of synthesis is similar to that used in photographic film development, in which silver grains within the film grow through addition of reduced silver onto their surface. Likewise, gold nanoparticles can act in conjunction with hydroquinone to catalyze reduction of ionic gold onto their surface. The presence of a stabilizer such as citrate results in controlled deposition of gold atoms onto the particles, and growth. Typically, the nanoparticle seeds are produced using the citrate method. The hydroquinone method complements that of Frens, as it extends the range of monodispersed spherical particle sizes that can be produced. Whereas the Frens method is ideal for particles of 12–20 nm, the hydroquinone method can produce particles of at least 30–300 nm.
Hitler's impressions of the Roman Pantheon were revived when on June 24, 1940, he made a tour of selected buildings in Paris, with German architects Speer and Giesler and sculptor Arno Breker, including the Paris Panthéon, which seems to have disappointed him, independently recorded by Giesler and Breker. The sketch of the Volkshalle given by Hitler to Speer shows a traditional gabled pronaos supported by ten columns, a shallow rectangular intermediate block and behind it the domed main building. Giesler notes that the pronaos of the temple in Hitler's sketch is reminiscent of Hadrian's Pantheon and of the style of Friedrich Gilly or Karl Friedrich Schinkel. However, there was little about Speer's elaboration of the sketch that might be termed Doric, except perhaps for the triglyphs in the entablature, supported by the geminated red granite columns with their Egyptian palm-leaf capitals, previously employed by Speer in the portico outside Hitler's study on the garden side of the new Chancellery.
Sources: en.wikipedia.org
Reversed-phase HPLC separates the sample into peaks, and the main peak is expressed as a percentage of total peak area. Mass spectrometry is then used to confirm that the molecular mass matches the expected value.
Low temperature and low moisture slow hydrolysis and oxidation, the two main degradation routes for short peptides. A desiccant limits water uptake each time the vial is opened.
No single number captures identity, counter-ion content, water content, or sterility. A purity figure from one laboratory method reflects only what that method detects, and different methods can give different values for the same sample.
Animal experiments form the bulk of the published record. Rodent models of tendon, ligament, bone, and gut injury are the most common designs. Controlled human trials are rare, which limits confidence in any clinical claim.